PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10004042
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 343aa    MW: 38189.7 Da    PI: 4.4487
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10004042genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.66.1e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT +Ed +l++ +  +G  +W+++++  g+ R++k+c++rw +yl
      Lus10004042 14 KGPWTGDEDRKLANFILTHGQFCWRSVPKLSGLLRCGKSCRLRWINYL 61
                     79******************99**********99************97 PP

2Myb_DNA-binding52.98.4e-1770111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++ E++l +d+++qlG++ W++Ia++m+ gRt++++k+ w+++
      Lus10004042  70 LSESEEKLVIDLHAQLGNR-WSKIASHMP-GRTDNEIKNQWNTH 111
                      5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-19563IPR009057Homeodomain-like
PROSITE profilePS5129412.388961IPR017930Myb domain
SuperFamilySSF466891.09E-2511108IPR009057Homeodomain-like
SMARTSM007178.2E-111363IPR001005SANT/Myb domain
PfamPF002491.9E-111461IPR001005SANT/Myb domain
CDDcd001671.25E-71661No hitNo description
PROSITE profilePS5129424.76862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-2464116IPR009057Homeodomain-like
SMARTSM007171.0E-1566114IPR001005SANT/Myb domain
PfamPF002491.1E-1470111IPR001005SANT/Myb domain
CDDcd001674.01E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTGD EDRKLANFIL THGQFCWRSV PKLSGLLRCG KSCRLRWINY  60
LRPDLKRGLL SESEEKLVID LHAQLGNRWS KIASHMPGRT DNEIKNQWNT HIKKKLREMG  120
IDPLTHQPLL PPPPPHEQES CSKDISTIEQ DPVLMNINVP LDSATEATSS ISSSSSSTIL  180
DNGLQLAITQ VANQLDVTDY HNVEQVLTYD DGFCLEDVLL VEPPEIITND CGNNNNIDIN  240
LEFSPPANLS SSSSKGTNNL ADDSANTNGG NDNTTLEAAE HERWWAPKLP TKEDQLMGLW  300
ADDDLGCWDL EVNDEFNCEI EMIAASLRSC LDDDDYSSRT CK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-26121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011001567.11e-91PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-77ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0E4B7Y24e-91A0A0E4B7Y2_POPNI; MYB transcriptional factor
TrEMBLU5FLU95e-91U5FLU9_POPTR; Myb family transcription factor family protein
STRINGPOPTR_0017s02850.11e-90(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.15e-80myb domain protein 20